PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF279000260CFD_t1
Common NameTRAES_3BF279000260CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 167aa    MW: 17613.2 Da    PI: 8.8354
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF279000260CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof83.22.6e-26102145245
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGa 45 
                              +++ l+cprCdstntkfCy+nnysl+qPr+fC+aCrryWt+   
  TRAES3BF279000260CFD_t1 102 PQSRLNCPRCDSTNTKFCYFNNYSLTQPRHFCRACRRYWTRVAR 145
                              67899***********************************8655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2586155IPR003851Zinc finger, Dof-type
PfamPF027011.1E-22105144IPR003851Zinc finger, Dof-type
PROSITE profilePS5088422.499106160IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MIFPPAFLDS SSCWNMNHDQ LQLQQIGNNT HITTVPSPAG HGDGGGNNNN LEGLMAAARA  60
GGGGGDGGGG SGGSGDGDGN GGRDSKQMSM SERARLARVP QPQSRLNCPR CDSTNTKFCY  120
FNNYSLTQPR HFCRACRRYW TRVARSAMSP GGGGYNFYSS TSNAPGN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753866.16e-47PREDICTED: dof zinc finger protein DOF3.2-like
TrEMBLA0A080YUU21e-120A0A080YUU2_WHEAT; Uncharacterized protein
STRINGMLOC_69454.16e-41(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.15e-32OBF-binding protein 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]